Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MDM1 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159376

 View more versions of this product

Catalog No. NBP159376


Only null left
Add to Cart

Description

Description

MDM1 Polyclonal specifically detects MDM1 in Human samples. It is validated for Western Blot.
Specifications

Specifications

MDM1
Polyclonal
Unconjugated
PBS, 2% Sucrose with 0.09% Sodium Azide
FLJ95264, Mdm1 nuclear protein homolog (mouse), Mdm4, transformed 3T3 cell double minute 1, p53 binding protein, Mdm4, transformed 3T3 cell double minute 1, p53 binding protein (mouse), nuclear protein double minute 1, nuclear protein MDM1
Rabbit
Affinity purified
RUO
56890
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot
0.5 mg/ml
Western Blot 1.0 ug/ml
B2RB22
MDM1
Synthetic peptides corresponding to MDM1(Mitochondrial deafness modifier 1) The peptide sequence was selected from the N terminal of MDM1. Peptide sequence GLRSDQLGITKEPSFISKRRVPYHDPQISKSLEWNGAISESNVVASPEPE.
100 μL
Primary
Expected identity based on immunogen sequence: Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Bovine: 92%; Chicken: 92%; Canine: 92%.
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
IgG
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.