Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MDM1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | MDM1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP159376
|
Novus Biologicals
NBP159376 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
MDM1 Polyclonal specifically detects MDM1 in Human samples. It is validated for Western Blot.Specifications
| MDM1 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| FLJ95264, Mdm1 nuclear protein homolog (mouse), Mdm4, transformed 3T3 cell double minute 1, p53 binding protein, Mdm4, transformed 3T3 cell double minute 1, p53 binding protein (mouse), nuclear protein double minute 1, nuclear protein MDM1 | |
| MDM1 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| B2RB22 | |
| 56890 | |
| Synthetic peptides corresponding to MDM1(Mitochondrial deafness modifier 1) The peptide sequence was selected from the N terminal of MDM1. Peptide sequence GLRSDQLGITKEPSFISKRRVPYHDPQISKSLEWNGAISESNVVASPEPE. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title