Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP154755

ME3 Antibody, Novus Biologicals™
SDP

Catalog No. NBP154755 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP154755 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP154755 Supplier Novus Biologicals Supplier No. NBP154755
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

ME3 Polyclonal specifically detects ME3 in Human samples. It is validated for Western Blot.

Specifications

Antigen ME3
Applications Western Blot
Classification Polyclonal
Clone Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Description Preservative: 0.09% Sodium Azide, Buffer: PBS and 2% Sucrose
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene ME3
Gene Accession No. Q16798
Gene Alias EC 1.1.1, EC 1.1.1.40, FLJ34862, malate dehydrogenase, Malic enzyme 3, malic enzyme 3, NADP(+)-dependent, mitochondrial, malic enzyme, NADP+-dependent, mitochondrial, mitochondrial NADP(+)-dependent malic enzyme 3, NADP-dependent malic enzyme, mitochondrial, NADP-ME, pyruvic-malic carboxylase
Gene Symbols ME3
Host Species Rabbit
Immunogen Synthetic peptides corresponding to ME3(malic enzyme 3, NADP(+)-dependent, mitochondrial) The peptide sequence was selected from the N terminal of ME3. Peptide sequence PGPARPVPLKKRGYDVTRNPHLNKGMAFTLEERLQLGIHGLIPPCFLSQD.
Molecular Weight of Antigen 67 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 10873
Target Species Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Rabbit, Sheep, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.