Learn More
Description
Specifications
Specifications
| Antigen | MED10 |
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunocytochemistry/Immunofluorescence 1-4 μg/mL |
| Formulation | PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide |
| Gene Alias | L6, mediator complex subunit 10TRG-17, mediator of RNA polymerase II transcription subunit 10, mediator of RNA polymerase II transcription, subunit 10, mediator of RNA polymerase II transcription, subunit 10 homolog (NUT2, S.cerevisiae), MGC5309, NUT2TRG-20, Transformation-related gene 17 protein, Transformation-related gene 20 protein, TRG20 |
| Gene Symbols | MED10 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MAEKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDITVP |
| Show More |
For Research Use Only
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
