Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. MED13 Antibody, Novus Biologicals™

MED13 Antibody, Novus Biologicals™
SDP

Catalog No. NB403437 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB403437 25 μL
NBP257545 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB403437 Supplier Novus Biologicals Supplier No. NBP25754525UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

MED13 Polyclonal specifically detects MED13 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

Antigen MED13
Applications Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 1-4 μg/mL
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias Activator-recruited cofactor 250 kDa component, KIAA0593HSPC221, mediator complex subunit 13ARC250, mediator of RNA polymerase II transcription, subunit 13 homolog, THRAP1mediator of RNA polymerase II transcription subunit 13, thyroid hormone receptor associated protein 1, Thyroid hormone receptor-associated protein 1, Thyroid hormone receptor-associated protein complex 240 kDa component, thyroid hormone receptor-associated protein complex component TRAP240, thyroid hormone receptor-associated protein, 240 kDa subunit, Trap240, TRAP240DRIP250, Vitamin D3 receptor-interacting protein complex component DRIP250
Gene Symbols MED13
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SASVQVASATYTTENLDLAFNPNNDGADGMGIFDLLDTGDDLDPDIINILPASPTGSPVHSPGSHYPHGGDAGKGQSTDRLLSTEPH
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 9969
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Form Purified
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.