MED13 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25754525UL

Catalog No. NB403437

Description

MED13 Polyclonal specifically detects MED13 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: MED13
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: Activator-recruited cofactor 250 kDa component, KIAA0593HSPC221, mediator complex subunit 13ARC250, mediator of RNA polymerase II transcription, subunit 13 homolog, THRAP1mediator of RNA polymerase II transcription subunit 13, thyroid hormone receptor associated protein 1, Thyroid hormone receptor-associated protein 1, Thyroid hormone receptor-associated protein complex 240 kDa component, thyroid hormone receptor-associated protein complex component TRAP240, thyroid hormone receptor-associated protein, 240 kDa subunit, Trap240, TRAP240DRIP250, Vitamin D3 receptor-interacting protein complex component DRIP250
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9969
• Target Species: Human
• Form: Purified

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: MED13
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SASVQVASATYTTENLDLAFNPNNDGADGMGIFDLLDTGDDLDPDIINILPASPTGSPVHSPGSHYPHGGDAGKGQSTDRLLSTEPH
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

For Research Use Only