Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MED14 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $646.00
Specifications
Antigen | MED14 |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
MED14 Polyclonal specifically detects MED14 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
MED14 | |
Polyclonal | |
Rabbit | |
Signal Transduction | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
9282 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PIAPPGTPAVVLKSKMLFFLQLTQKTSVPPQEPVSIIVPIIYDMASGTTQQADIPRQQNSSVAAPMMVSNILKRFAEMNP | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
Human | |
Activator-recruited cofactor 150 kDa component, ARC150, Cofactor required for Sp1 transcriptional activation subunit 2, cofactor required for Sp1 transcriptional activation, subunit 2 (150kD), CRSP150, CRSP2cofactor required for Sp1 transcriptional activation, subunit 2, 150kDa, CSRP, CXorf4MGC104513, EXLM1CRSP complex subunit 2, human homolog of yeast RGR1, mediator complex subunit 14DRIP150, mediator of RNA polymerase II transcription subunit 14, RGR1RGR1 homolog, Thyroid hormone receptor-associated protein complex 170 kDa component, thyroid hormone receptor-associated protein complex component TRAP170, transcriptional co-activator CRSP150, Transcriptional coactivator CRSP150, Trap170, TRAP170hRGR1, vitamin D receptor-interacting protein complex component DRIP150, Vitamin D3 receptor-interacting protein complex 150 kDa component | |
MED14 | |
IgG | |
Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title