MED19 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179597

Catalog No. NBP179597

Description

MED19 Polyclonal specifically detects MED19 in Human, Rat samples. It is validated for Western Blot.

Specifications

• Antigen: MED19
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: LCMR1mediator of RNA polymerase II transcription subunit 19, Lung cancer metastasis-related protein 1, mediator complex subunit 19DT2P1G7, mediator of RNA polymerase II transcription, subunit 19 homolog, mediator of RNA polymerase II transcription, subunit 19 homolog (S. cerevisiae)
• Host Species: Rabbit
• Molecular Weight of Antigen: 27 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: D3ZAP1
• Gene Symbols: MED19
• Immunogen: Synthetic peptide corresponding to a region of Rat MED19 (NP_001101211). Peptide sequence MRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMID.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 219541
• Target Species: Human, Rat, Pig, Bovine, Canine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG