Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MED19 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$158.00 - $487.50
Specifications
| Antigen | MED19 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17959720
|
Novus Biologicals
NBP17959720UL |
20 μL |
Each for $158.00
|
|
|||||
|
NBP179597
|
Novus Biologicals
NBP179597 |
100 μL |
Each for $487.50
|
|
|||||
Description
MED19 Polyclonal specifically detects MED19 in Human, Rat samples. It is validated for Western Blot.Specifications
| MED19 | |
| Polyclonal | |
| Rabbit | |
| D3ZAP1 | |
| 219541 | |
| Synthetic peptide corresponding to a region of Rat MED19 (NP_001101211). Peptide sequence MRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMID. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| LCMR1mediator of RNA polymerase II transcription subunit 19, Lung cancer metastasis-related protein 1, mediator complex subunit 19DT2P1G7, mediator of RNA polymerase II transcription, subunit 19 homolog, mediator of RNA polymerase II transcription, subunit 19 homolog (S. cerevisiae) | |
| MED19 | |
| IgG | |
| 27 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title