MED19 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP181320

Catalog No. NBP181320

Description

MED19 Polyclonal specifically detects MED19 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: MED19
• Classification: Polyclonal
• Dilution: Western Blot 0.04 to 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
• Gene Alias: LCMR1mediator of RNA polymerase II transcription subunit 19, Lung cancer metastasis-related protein 1, mediator complex subunit 19DT2P1G7, mediator of RNA polymerase II transcription, subunit 19 homolog, mediator of RNA polymerase II transcription, subunit 19 homolog (S. cerevisiae)
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 219541
• Target Species: Human
• Isotype: IgG

• Applications: Immunofluorescence, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: MED19
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:GSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPV
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only