MED23 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP256372

Catalog No. NBP256372

Description

MED23 Polyclonal specifically detects MED23 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: MED23
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: 130 kDa transcriptional co-activator, 133 kDa transcriptional co-activator, CRSP130, DRIP130DKFZp434H0117, mediator complex subunit 23CRSP133, Protein sur-2 homolog, subunit 3, 130kDa, Transcriptional coactivator CRSP130, Vitamin D3 receptor-interacting protein complex 130 kDa component
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: MED23
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PATLRFPLKGLLPYDKDLFEPQTALLRYVLEQPYSRDMVCNMLGLNKQHKQRCPVLEDQLVDLVVYAMERSETEEKFDDG
• Quantity: 100 μL
• Research Discipline: Cell Biology, Signal Transduction, Transcription Factors and Regulators
• Gene ID (Entrez): 9439
• Target Species: Human
• Isotype: IgG

For Research Use Only