Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MED23 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$254.42 - $728.30
Specifications
| Antigen | MED23 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
MED23 Polyclonal specifically detects MED23 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| MED23 | |
| Polyclonal | |
| Rabbit | |
| Cell Biology, Signal Transduction, Transcription Factors and Regulators | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 9439 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PATLRFPLKGLLPYDKDLFEPQTALLRYVLEQPYSRDMVCNMLGLNKQHKQRCPVLEDQLVDLVVYAMERSETEEKFDDG | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 130 kDa transcriptional co-activator, 133 kDa transcriptional co-activator, CRSP130, DRIP130DKFZp434H0117, mediator complex subunit 23CRSP133, Protein sur-2 homolog, subunit 3, 130kDa, Transcriptional coactivator CRSP130, Vitamin D3 receptor-interacting protein complex 130 kDa component | |
| MED23 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title