MED8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155435

Catalog No. NBP155435

Description

MED8 Polyclonal specifically detects MED8 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: MED8
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ARC32subunit 8 homolog, mediator complex subunit 8mediator of RNA polymerase II transcription, subunit 8 homolog (S. cerevisiae)
• Host Species: Rabbit
• Molecular Weight of Antigen: 33 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: This product is specific to Subunit or Isoform: 8.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q96G25-2
• Gene Symbols: MED8
• Immunogen: Synthetic peptides corresponding to MED8(mediator complex subunit 8) The peptide sequence was selected from the N terminal of MED8. Peptide sequence MQREEKQLEASLDALLSQVADLKNSLGSFICKLENEYGRLTWPSVLDSFA.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 112950
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.