Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MED8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | MED8 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
MED8 Polyclonal specifically detects MED8 in Human samples. It is validated for Western Blot.Specifications
MED8 | |
Polyclonal | |
Rabbit | |
Q96G25-2 | |
112950 | |
Synthetic peptides corresponding to MED8(mediator complex subunit 8) The peptide sequence was selected from the N terminal of MED8. Peptide sequence MQREEKQLEASLDALLSQVADLKNSLGSFICKLENEYGRLTWPSVLDSFA. | |
Primary | |
33 kDa |
Western Blot | |
Unconjugated | |
RUO | |
ARC32subunit 8 homolog, mediator complex subunit 8mediator of RNA polymerase II transcription, subunit 8 homolog (S. cerevisiae) | |
MED8 | |
IgG | |
This product is specific to Subunit or Isoform: 8. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title