Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. MEF2B Antibody, Novus Biologicals™

MEF2B Antibody, Novus Biologicals™
SDP

Catalog No. NBP180218 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP180218 100 μL
NBP18021820 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP180218 Supplier Novus Biologicals Supplier No. NBP180218

Description

Rabbit Polyclonal Antibody

MEF2B Polyclonal specifically detects MEF2B in Human, Mouse samples. It is validated for Western Blot.

Specifications

Antigen MEF2B
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_032604
Gene Alias LOC729991-MEF2B readthrough transcript, MEF2B, myocyte enhancer factor 2B
Gene Symbols MEF2BNB-MEF2B
Host Species Rabbit
Immunogen Synthetic peptide directed towards the C terminal of human MEF2B. Peptide sequence PVARSLCKEGPPSRGASPPTPPVSIKSERLSPVTGTSGDFPRSFPYPLLL.
Molecular Weight of Antigen 38 kDa
Purification Method Protein A purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 4207
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.