Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MEF2B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP18021820UL
Description
MEF2B Polyclonal specifically detects MEF2B in Human, Mouse samples. It is validated for Western Blot.Specifications
MEF2B | |
Polyclonal | |
Western Blot 1:1000 | |
NP_032604 | |
MEF2BNB-MEF2B | |
Synthetic peptide directed towards the C terminal of human MEF2B. Peptide sequence PVARSLCKEGPPSRGASPPTPPVSIKSERLSPVTGTSGDFPRSFPYPLLL. | |
Protein A purified | |
RUO | |
4207 | |
Store at -20C. Avoid freeze-thaw cycles. | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
LOC729991-MEF2B readthrough transcript, MEF2B, myocyte enhancer factor 2B | |
Rabbit | |
38 kDa | |
20 μL | |
Primary | |
Human, Mouse | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction