Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MEF2B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $464.00
Specifications
| Antigen | MEF2B |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP18021820
|
Novus Biologicals
NBP18021820UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP180218
|
Novus Biologicals
NBP180218 |
100 μL |
Each for $464.00
|
|
|||||
Description
MEF2B Polyclonal specifically detects MEF2B in Human, Mouse samples. It is validated for Western Blot.Specifications
| MEF2B | |
| Polyclonal | |
| Purified | |
| RUO | |
| NP_032604 | |
| 4207 | |
| Synthetic peptide directed towards the C terminal of human MEF2B. Peptide sequence PVARSLCKEGPPSRGASPPTPPVSIKSERLSPVTGTSGDFPRSFPYPLLL. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| LOC729991-MEF2B readthrough transcript, MEF2B, myocyte enhancer factor 2B | |
| MEF2BNB-MEF2B | |
| IgG | |
| Protein A purified | |
| 38 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title