Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MEF2B Rabbit, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP18021820UL

 View more versions of this product

Catalog No. NBP18021820


Add to cart

Description

Description

MEF2B Polyclonal antibody specifically detects Antigen in Human, Mouse samples. It is validated for Western Blotting.
Specifications

Specifications

MEF2B
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Purified
MEF2BNB-MEF2B
Synthetic peptide directed towards the C terminal of human MEF2B. Peptide sequence PVARSLCKEGPPSRGASPPTPPVSIKSERLSPVTGTSGDFPRSFPYPLLL.
38 kDa
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human, Mouse
Western Blot
Western Blot 1:1000
NP_032604
LOC729991-MEF2B readthrough transcript, MEF2B, myocyte enhancer factor 2B
Rabbit
IgG
Protein A purified
RUO
Primary
4207
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit