Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MEIOB Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17044020UL
Description
MEIOB Polyclonal specifically detects MEIOB in Human samples. It is validated for Western Blot.Specifications
| C16orf73 | |
| Polyclonal | |
| Western Blot 1:100-1:2000 | |
| C16orf73, chromosome 16 open reading frame 73, gs129, meiosis specific with OB domains | |
| Rabbit | |
| 22 kDa | |
| 20 μL | |
| Primary | |
| Human | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| MEIOB | |
| Synthetic peptides corresponding to C16orf73 (chromosome 16 open reading frame 73) The peptide sequence was selected from the middle region of C16orf73. Peptide sequence CSLTGSVAEETLGCTFVLSHRARSGLKISVLSCKLADPTEASRNLSGQKH. | |
| Affinity Purified | |
| RUO | |
| 254528 | |
| Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction