Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MEIOB Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | C16orf73 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP170440
|
Novus Biologicals
NBP170440 |
100 μL |
Each for $480.74
|
|
|||||
|
NBP17044020
|
Novus Biologicals
NBP17044020UL |
20 μL | N/A | N/A | N/A | ||||
Description
MEIOB Polyclonal specifically detects MEIOB in Human samples. It is validated for Western Blot.Specifications
| C16orf73 | |
| Polyclonal | |
| Rabbit | |
| C16orf73, chromosome 16 open reading frame 73, gs129, meiosis specific with OB domains | |
| MEIOB | |
| IgG | |
| 22 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 254528 | |
| Synthetic peptides corresponding to C16orf73 (chromosome 16 open reading frame 73) The peptide sequence was selected from the middle region of C16orf73. Peptide sequence CSLTGSVAEETLGCTFVLSHRARSGLKISVLSCKLADPTEASRNLSGQKH. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title