| Antigen |
MEKK1 |
| Applications |
Western Blot, Flow Cytometry, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence |
| Classification |
Monoclonal |
| Clone |
2F6 |
| Conjugate |
DyLight 680 |
| Dilution |
Western Blot, Flow Cytometry, Immunohistochemistry, Immunohistochemistry-Paraffin, Immunofluorescence |
| Formulation |
50mM Sodium Borate with 0.05% Sodium Azide |
| Gene Alias |
Map3k1, MAPK/ERK kinase kinase 1, MAPKKK1MAP/ERK kinase kinase 1, MEK kinase 1, MEKK1EC 2.7.11.25, MEKKMEKK 1, mitogen-activated protein kinase kinase kinase 1 |
| Gene Symbols |
MAP3K1 |
| Host Species |
Mouse |
| Immunogen |
Partial recombinant MEKK1 (aa1077-1176) (SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTP-VEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK) (Uniprot: Q13233) |
| Purification Method |
Protein A or G purified |
| Quantity |
0.1 mL |
| Research Discipline |
Angiogenesis, Breast Cancer, Cancer, Lipid and Metabolism, MAP Kinase Signaling, mTOR Pathway, Phospho Specific, Protein Kinase, Signal Transduction, Tyrosine Kinases |
| Primary or Secondary |
Primary |
| Gene ID (Entrez) |
4214 |
| Test Specificity |
Mitogen-activated protein (MAP) kinase cascades are activated by various extracellular stimuli, including growth factors. The MEK kinases (also designated MAP kinase kinase kinases, MKKKs, MAP3Ks or MEKKs) phosphorylate and thereby activate the MEKs (also called MAP kinase kinases or MKKs), including ERK, JNK and p38. These activated MEKs in turn phosphorylate and activate the MAP kinases. The MEK kinases include Raf-1, Raf-B, Mos, MEK kinase-1, MEK kinase-2, MEK kinase-3, MEK kinase-4 and ASK 1 (MEK kinase- 5). MEK kinase-1 activates the ERK and c-Jun NH2-terminal kinase (JNK) pathways by phosphorylation of MAP2K1 and MAP2K4, and also activates the central protein kinases of the NF B pathway, CHUK and IKBKB. Additionally, MEK kinase-1 uses an E3 ligase through its PHD domain, a RING-finger-like structure, to target proteins for degradation through ubiquitination. |
| Target Species |
Human |
| Content And Storage |
Store at 4C in the dark. |
| Form |
Purified |
| Isotype |
IgG2a κ |
|
Show More
Show Less
|
|