Melanoma Antigen Family B5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP230617

Catalog No. NBP230617

Description

Melanoma Antigen Family B5 Polyclonal specifically detects Melanoma Antigen Family B5 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Melanoma Antigen Family B5
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: Q9BZ81
• Gene Symbols: MAGEB5
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: NAGSDERANSRDEEYPCSSEVSPSTESSCSNFINIKVGLLEQFLLY
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: Cancer/Testis Antigen 3.3, Cancer/Testis Antigen Family 3, Cancer/Testis Antigen Family 3, Member 3, CT3.3, MAGE Family Testis And Tumor-Specific Protein, MAGEB5, MAGE-B5, MAGE-B5 Antigen, Melanoma-Associated Antigen B5, Member 3
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 347541
• Target Species: Human
• Isotype: IgG

For Research Use Only