MERIT40/HSPC142 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP258126

Catalog No. NBP258126

Description

MERIT40/HSPC142 Polyclonal specifically detects MERIT40/HSPC142 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: MERIT40/HSPC142
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: BRISC and BRCA1 A complex member 1, C10orf62, C19orf62, chromosome 19 open reading frame 62, FLJ20571, HSPC142, mediator of Rap80 interactions and targeting 40 kDa, Mediator of RAP80 interactions and targeting subunit of 40 kDa, MERIT40BRCA1-A complex subunit MERIT40, NBA1BRISC and BRCA1 A complex member, new component of the BRCA1 A complex, New component of the BRCA1-A complex, new component of the BRCAA1 A complex
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: BABAM1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EEEHSAEPRPRTRSNPEGAEDRAVGAQASVGSRSEGEGEAASADDGSLNTSGAGPKSWQVPPPAPEVQIRTPRVNCPEKVIICL
• Quantity: 100 μL
• Research Discipline: DNA replication Transcription Translation and Splicing
• Gene ID (Entrez): 29086
• Target Species: Human
• Isotype: IgG

For Research Use Only