Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. MERIT40/HSPC142 Antibody, Novus Biologicals™

MERIT40/HSPC142 Antibody, Novus Biologicals™
SDP

Catalog No. NBP156773 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP156773 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP156773 Supplier Novus Biologicals Supplier No. NBP156773
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

MERIT40/HSPC142 Polyclonal specifically detects MERIT40/HSPC142 in Human samples. It is validated for Western Blot.

Specifications

Antigen MERIT40/HSPC142
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9NWV8
Gene Alias BRISC and BRCA1 A complex member 1, C10orf62, C19orf62, chromosome 19 open reading frame 62, FLJ20571, HSPC142, mediator of Rap80 interactions and targeting 40 kDa, Mediator of RAP80 interactions and targeting subunit of 40 kDa, MERIT40BRCA1-A complex subunit MERIT40, NBA1BRISC and BRCA1 A complex member, new component of the BRCA1 A complex, New component of the BRCA1-A complex, new component of the BRCAA1 A complex
Gene Symbols BABAM1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to C19ORF62 The peptide sequence was selected from the N terminal of C19ORF62. Peptide sequence DRAVGAQASVGSRSEGEGEAASADDGSLNTSGAGPKSWQVPPPAPEVQIR.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline DNA replication Transcription Translation and Splicing
Primary or Secondary Primary
Gene ID (Entrez) 29086
Test Specificity This product is specific to Subunit or Isoform: MERIT40.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.