Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Mesothelin Rabbit anti-Human, Rat, Clone: 5R9H8, Novus Biologicals™
SDP

Catalog No. NB168646 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
20 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB168646 20 μg
NB168645 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB168646 Supplier Novus Biologicals Supplier No. NBP31677720UL
Add to Cart
Add to Cart

Rabbit Monoclonal Antibody

Mesothelin Monoclonal antibody specifically detects Mesothelin in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunofluorescence

Specifications

Antigen Mesothelin
Applications Western Blot, Immunohistochemistry, Immunofluorescence
Classification Monoclonal
Clone 5R9H8
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200
Formulation PBS, 0.05% BSA, 50% glycerol, pH7.3
Gene Alias CAK1, CAK1 antigen, megakaryocyte potentiating factor, mesothelin, MPFSMRP, Pre-pro-megakaryocyte-potentiating factor, soluble MPF mesothelin related protein
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 500-600 of human Mesothelin (Q13421). YFVKIQSFLGGAPTEDLKALSQQNVSMDLATFMKLRTDAVLPLTVAEVQKLLGPHVEGLKAEERHRPVRDWILRQRQDDLDTLGLGLQGGIPNGYLVLDLS
Purification Method Affinity purified
Quantity 20 μg
Regulatory Status RUO
Research Discipline Cancer
Primary or Secondary Primary
Gene ID (Entrez) 10232
Target Species Human, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.