Learn More
Description
Specifications
Specifications
| Antigen | Methionine Aminopeptidase 1D/MAP1D |
| Applications | Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Formulation | PBS (pH 7.2), 40% Glycerol |
| Gene Alias | EC 3.4.11.18, MAP1DCDS of metAP-3 within PCR fragment, Metap1l, methionine aminopeptidase 1D, mitochondrial, methionyl aminopeptidase type 1D (mitochondrial), Methionyl aminopeptidase type 1D, mitochondrial |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VGNVDECGKKLVEVARRCRDEAIAACRAGAPFSVIGNTISHITHQNGFQVCPHFVGHGIGSYFHGHPEIWHHA |
| Purification Method | Immunogen affinity purified |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
