Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Methionine Aminopeptidase 1D/MAP1D Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00
Specifications
Antigen | Methionine Aminopeptidase 1D/MAP1D |
---|---|
Dilution | Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200 |
Applications | Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
Methionine Aminopeptidase 1D/MAP1D Polyclonal antibody specifically detects Methionine Aminopeptidase 1D/MAP1D in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)Specifications
Methionine Aminopeptidase 1D/MAP1D | |
Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
Rabbit | |
Immunology | |
PBS (pH 7.2), 40% Glycerol | |
254042 | |
IgG | |
Immunogen affinity purified |
Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
Polyclonal | |
Purified | |
RUO | |
Human | |
EC 3.4.11.18, MAP1DCDS of metAP-3 within PCR fragment, Metap1l, methionine aminopeptidase 1D, mitochondrial, methionyl aminopeptidase type 1D (mitochondrial), Methionyl aminopeptidase type 1D, mitochondrial | |
This antibody was developed against a recombinant protein corresponding to amino acids: VGNVDECGKKLVEVARRCRDEAIAACRAGAPFSVIGNTISHITHQNGFQVCPHFVGHGIGSYFHGHPEIWHHA | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title