Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Methionyl tRNA synthetase 2 Antibody, Novus Biologicals™

Methionyl tRNA synthetase 2 Antibody, Novus Biologicals™
SDP

Catalog No. NB397279 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB397279 25 μL
NBP234013 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB397279 Supplier Novus Biologicals Supplier No. NBP23401325UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Methionyl tRNA synthetase 2 Polyclonal specifically detects Methionyl tRNA synthetase 2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen Methionyl tRNA synthetase 2
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q96GW9
Gene Alias EC 6.1.1, EC 6.1.1.10, methionine tRNA ligase 2, mitochondrial, methionine-tRNA ligase, Methionine--tRNA ligase 2, methionine-tRNA synthetase 2 (mitochondrial), methionine-tRNA synthetase 2, mitochondrial, methionyl-tRNA synthetase 2, mitochondrial, methionyl-tRNA synthetase, mitochondrial, MetRS, Mitochondrial methionine--tRNA ligase, mitochondrial methionyl-tRNA synthetase, mtMetRS
Gene Symbols MARS2
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: LLNSELADALGGLLNRCTAKRINPSETYPAFCTTCFPSEPGLVGPSVRAQAEDYALVSAVATLPKQVADHYDNFRIYKALEAVSSCVRQTNG
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 92935
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.