METTL1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP154928

Catalog No. NBP154928

Description

METTL1 Polyclonal specifically detects METTL1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: METTL1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: METTL1
• Immunogen: Synthetic peptides corresponding to METTL1(methyltransferase like 1) The peptide sequence was selected from the middle region of METTL1. Peptide sequence KGQLTKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRVGGLVYTITDV.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 4234
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: C12orf1, D1075-like gene product, EC 2.1.1.33, FLJ95748, methyltransferase like 1, methyltransferase-like 1, Methyltransferase-like protein 1, TRM8, tRNA (guanine-N(7)-)-methyltransferase, tRNA(m7G46)-methyltransferase, YDL201w
• Host Species: Rabbit
• Molecular Weight of Antigen: 34 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Yeast: 87%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Yeast, Zebrafish
• Form: Purified