Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
METTL1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | METTL1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15492820
|
Novus Biologicals
NBP15492820UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP154928
|
Novus Biologicals
NBP154928 |
100 μL |
Each for $487.50
|
|
|||||
Description
METTL1 Polyclonal specifically detects METTL1 in Human samples. It is validated for Western Blot.Specifications
| METTL1 | |
| Polyclonal | |
| Purified | |
| RUO | |
| 4234 | |
| Synthetic peptides corresponding to METTL1(methyltransferase like 1) The peptide sequence was selected from the middle region of METTL1. Peptide sequence KGQLTKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRVGGLVYTITDV. | |
| Primary | |
| 34 kDa |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| C12orf1, D1075-like gene product, EC 2.1.1.33, FLJ95748, methyltransferase like 1, methyltransferase-like 1, Methyltransferase-like protein 1, TRM8, tRNA (guanine-N(7)-)-methyltransferase, tRNA(m7G46)-methyltransferase, YDL201w | |
| METTL1 | |
| IgG | |
| Protein A purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title