MFSD1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159624

Catalog No. NBP159624

Description

MFSD1 Polyclonal specifically detects MFSD1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: MFSD1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FLJ14153, major facilitator superfamily domain containing 1, major facilitator superfamily domain-containing protein 1, SMAP4, SMAP-4, Smooth muscle cell-associated protein 4, UG0581B09
• Host Species: Rabbit
• Molecular Weight of Antigen: 51 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9H3U5
• Gene Symbols: MFSD1
• Immunogen: Synthetic peptides corresponding to MFSD1(major facilitator superfamily domain containing 1) The peptide sequence was selected from the middle region of MFSD1. Peptide sequence RFVFGIGGESLAVAQNTYAVSWFKGKELNLVFGLQLSMARIGSTVNMNLM.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 64747
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG