Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MFSD1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | MFSD1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
MFSD1 Polyclonal specifically detects MFSD1 in Human samples. It is validated for Western Blot.Specifications
MFSD1 | |
Polyclonal | |
Rabbit | |
Q9H3U5 | |
64747 | |
Synthetic peptides corresponding to MFSD1(major facilitator superfamily domain containing 1) The peptide sequence was selected from the middle region of MFSD1. Peptide sequence RFVFGIGGESLAVAQNTYAVSWFKGKELNLVFGLQLSMARIGSTVNMNLM. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
FLJ14153, major facilitator superfamily domain containing 1, major facilitator superfamily domain-containing protein 1, SMAP4, SMAP-4, Smooth muscle cell-associated protein 4, UG0581B09 | |
MFSD1 | |
IgG | |
51 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title