MFSD8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179595

Catalog No. NBP179595

Description

MFSD8 Polyclonal specifically detects MFSD8 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: MFSD8
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ceroid-lipofuscinosis, neuronal 7, late infantile, variant, CLN7, major facilitator superfamily domain containing 8, major facilitator superfamily domain-containing protein 8, MGC33302neuronal 7, late infantile
• Host Species: Rabbit
• Molecular Weight of Antigen: 57 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Rabbit: 100%; Bovine: 92%; Canine: 92%; Guinea pig: 92%; Equine: 92%; Mouse: 92%; Pig: 92%; Rat: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_689991
• Gene Symbols: MFSD8
• Immunogen: Synthetic peptide directed towards the middle region of human MFSD8The immunogen for this antibody is MFSD8. Peptide sequence FFILLPWGNQFPKIQWEDLHNNSIPNTTFGEIIIGLWKSPMEDDNERPTG.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 256471
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.