MGAT2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP16244120UL

Catalog No. NBP1624420

Description

MGAT2 Polyclonal specifically detects MGAT2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: MGAT2
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000
• Gene Accession No.: Q10469
• Gene Symbols: MGAT2
• Immunogen: Synthetic peptides corresponding to MGAT2(mannosyl (alpha-1,6-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase) The peptide sequence was selected from the middle region of MGAT2. Peptide sequence YAGLILFLEEDHYLAPDFYHVFKKMWKLKQQECPEC
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 4247
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase, Beta-1,2-N-acetylglucosaminyltransferase II, CDG2A, EC 2.4.1.143, GlcNAc-T II, GLCNACTII, GNT2, GNT-IICDGS2, Mannoside acetylglucosaminyltransferase 2, mannosyl (alpha-1,6-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase, N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase II, UDP-N-acetylglucosamine:alpha-6-D-mannosidebeta-1,2-N-acetylglucosaminyltransferase II
• Host Species: Rabbit
• Molecular Weight of Antigen: 51 kDa
• Quantity: 20 μL
• Primary or Secondary: Primary
• Target Species: Human
• Isotype: IgG