Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MGAT4EP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP170608
Description
MGAT4EP Polyclonal specifically detects MGAT4EP in Human samples. It is validated for Western Blot.Specifications
LOC641515 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
LOC641515 uncharacterized LOC641515 | |
Rabbit | |
40 kDa | |
100 μL | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
LOC641515 | |
Synthetic peptides corresponding to LOC641515(hypothetical protein LOC641515) The peptide sequence was selected from the C terminal of LOC641515. Peptide sequence FWTHNISIGNHLTVILNHPANLSRVQVMTGSIVEWEVRPGEGAGGAGLPT. | |
Affinity Purified | |
RUO | |
641515 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction