Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MGAT4EP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$464.00
Specifications
Antigen | LOC641515 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
MGAT4EP Polyclonal specifically detects MGAT4EP in Human samples. It is validated for Western Blot.Specifications
LOC641515 | |
Polyclonal | |
Rabbit | |
Human | |
LOC641515 uncharacterized LOC641515 | |
LOC641515 | |
IgG | |
Affinity Purified | |
40 kDa |
Western Blot | |
Unconjugated | |
RUO | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
641515 | |
Synthetic peptides corresponding to LOC641515(hypothetical protein LOC641515) The peptide sequence was selected from the C terminal of LOC641515. Peptide sequence FWTHNISIGNHLTVILNHPANLSRVQVMTGSIVEWEVRPGEGAGGAGLPT. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title