Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. mGluR6 Antibody, Novus Biologicals™

mGluR6 Antibody, Novus Biologicals™
SDP

Catalog No. NB393482 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB393482 25 μL
NBP258374 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB393482 Supplier Novus Biologicals Supplier No. NBP25837425UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

mGluR6 Polyclonal specifically detects mGluR6 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen mGluR6
Applications Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
Gene Alias CSNB1B, glutamate receptor, metabotropic 6, GPRC1Fmetabotropic glutamate receptor 6, mGlu6, mGluR6, MGLUR6DKFZp686H1993
Gene Symbols GRM6
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VMFNENGDAPGRYDIFQYQATNGSASSGGYQAVGQWAETLRLDVEALQWSGDPHEVPSSLCSLPCGPGERKKMVKGV
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Amino Acids Drugs and other small molecules, GPCR, Metabotropic Glutamate Receptors, Neuronal Cell Markers, Neuroscience, Neurotransmission, Sensory Systems, Signal Transduction, Vision
Primary or Secondary Primary
Gene ID (Entrez) 2916
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.