MICAL1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23815425UL

Catalog No. NB436299

Description

MICAL1 Polyclonal specifically detects MICAL1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: MICAL1
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Accession No.: Q8TDZ2
• Gene Symbols: MICAL1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LSSLNLTPDPEMEPPPKPPRSCSALARHALESSFVGWGLPVQSPQALVAMEKEEKESPFSSEEEEEDVPLDSDVEQALQTFAKTSGTMNNYPT
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: CasL interacting molecule, DKFZp434B1517, FLJ11937, FLJ21739, MICALMolecule interacting with CasL protein 1, microtubule associated monoxygenase, calponin and LIM domain containing 1, NEDD9 interacting protein with calponin homology and LIM domains, NEDD9-interacting protein with calponin homology and LIM domains, NICALMICAL-1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 64780
• Target Species: Human
• Isotype: IgG