MID1IP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP18462925UL

Catalog No. NB432521

Description

MID1IP1 Polyclonal specifically detects MID1IP1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: MID1IP1
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: FLJ10386, G12-like, Gastrulation-specific G12-like protein, MID1 interacting protein 1 (gastrulation specific G12 homolog (zebrafish)), MID1 interacting protein 1 (gastrulation specific G12-like (zebrafish)), MID1 interacting protein 1 (gastrulation specific G12-like), Mid1-interacting G12-like protein, mid1-interacting protein 1, MIG12MID1 interacting G12-like protein, Protein STRAIT11499, S14R, Spot 14-R, Spot 14-related protein, STRAIT11499, THRSPL
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: MID1IP1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:CLEERTPPVPDSGSANGSFFAPSRDMYSHYVLLKSIRNDIEWGVLHQPPPPAGSEEGSAWKSKDILVDLGHLEGA
• Quantity: 25 μL
• Research Discipline: Core ESC Like Genes, Stem Cell Markers
• Gene ID (Entrez): 58526
• Target Species: Human
• Isotype: IgG

For Research Use Only