MID1IP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB432521	Novus Biologicals NBP18462925UL	25 μL
NBP184629	Novus Biologicals NBP184629	0.1 mL

Description

MID1IP1 Polyclonal specifically detects MID1IP1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: MID1IP1
• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: FLJ10386, G12-like, Gastrulation-specific G12-like protein, MID1 interacting protein 1 (gastrulation specific G12 homolog (zebrafish)), MID1 interacting protein 1 (gastrulation specific G12-like (zebrafish)), MID1 interacting protein 1 (gastrulation specific G12-like), Mid1-interacting G12-like protein, mid1-interacting protein 1, MIG12MID1 interacting G12-like protein, Protein STRAIT11499, S14R, Spot 14-R, Spot 14-related protein, STRAIT11499, THRSPL
• Gene Symbols: MID1IP1
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Core ESC Like Genes, Stem Cell Markers
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 58526
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:CLEERTPPVPDSGSANGSFFAPSRDMYSHYVLLKSIRNDIEWGVLHQPPPPAGSEEGSAWKSKDILVDLGHLEGA
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only