MINDY4B/FAM188B2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP318693100UL

Catalog No. NB170455

Description

MINDY4B/FAM188B2 Polyclonal antibody specifically detects MINDY4B/FAM188B2 in Human samples. It is validated for Western Blot

Specifications

• Antigen: MINDY4B/FAM188B2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene Alias: C3orf76, epididymis secretory sperm binding protein, FAM188B2, family with sequence similarity 188 member B2, inactive ubiquitin carboxyl-terminal hydrolase MINDY-4B, protein FAM188B2, Putative UPF0526 protein B
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MINDY4B/FAM188B2 (LOC646951): SQETLHGVLTRSDVGYLQWGKDASEDDRLSQVGSMLKTPKLPIWLCNING
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Formulation: 1x PBS in 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 646951
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.