Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MINDY4B/FAM188B2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$458.00

Specifications

Antigen	MINDY4B/FAM188B2
Concentration	0.5 mg/ml
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NB170455 View Documents View Product Certificates	Novus Biologicals NBP318693100UL	100 μg	Each of 1 for $458.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

MINDY4B/FAM188B2 Polyclonal antibody specifically detects MINDY4B/FAM188B2 in Human samples. It is validated for Western Blot

Specifications

Antigen	MINDY4B/FAM188B2
Applications	Western Blot
Conjugate	Unconjugated
Host Species	Rabbit
Target Species	Human
Gene Alias	C3orf76, epididymis secretory sperm binding protein, FAM188B2, family with sequence similarity 188 member B2, inactive ubiquitin carboxyl-terminal hydrolase MINDY-4B, protein FAM188B2, Putative UPF0526 protein B
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human MINDY4B/FAM188B2 (LOC646951): SQETLHGVLTRSDVGYLQWGKDASEDDRLSQVGSMLKTPKLPIWLCNING
Purification Method	Affinity purified

Concentration	0.5 mg/ml
Classification	Polyclonal
Form	Purified
Regulatory Status	RUO
Formulation	1x PBS in 2% sucrose
Gene ID (Entrez)	646951
Primary or Secondary	Primary
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

MINDY4B/FAM188B2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Specifications

Description

Specifications

Documents