MIST1 Antibody, Novus Biologicals™

Catalog No.	Quantity
NBP230979	0.1 mL

Catalog No. NBP230979 Supplier Novus Biologicals Supplier No. NBP230979

Description

Rabbit Polyclonal Antibody

MIST1 Polyclonal specifically detects MIST1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: MIST1
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Classification: Polyclonal
• Conjugate: Unconjugated
• Dilution: Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Accession No.: Q7RTS1
• Gene Alias: basic helix-loop-helix domain containing, class B, 8, basic helix-loop-helix family, member a15, bHLHa15, bHLHb8, class A basic helix-loop-helix protein 15, Class B basic helix-loop-helix protein 8, class II bHLH protein MIST1, MIST1MIST-1, Muscle, intestine and stomach expression 1
• Gene Symbols: BHLHA15
• Host Species: Rabbit
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: AKNYIKSLTATILTMSSSRLPGLEGPGPKLYQHYQQQQQVAGGALGATEAQPQGHLQRYSTQIHSFREG
• Purification Method: Affinity Purified
• Quantity: 0.1 mL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 168620
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Target Species: Human
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only