Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MITD1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP157007
Description
MITD1 Polyclonal specifically detects MITD1 in Human samples. It is validated for Western Blot.Specifications
MITD1 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
LOC129531, MIT domain-containing protein 1, MIT, microtubule interacting and transport, domain containing 1 | |
Rabbit | |
Affinity purified | |
RUO | |
129531 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q8WV92 | |
MITD1 | |
Synthetic peptides corresponding to MITD1 (MIT, microtubule interacting and transport, domain containing 1) The peptide sequence was selected from the middle region of MITD1. Peptide sequence SHGVLLEVQYSSSIHDREIRFNNGWMIKIGRGLDYFKKPQSRFSLGYCDF The peptide sequence for this immunogen was taken from within the described region. | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Human: 100%; Xenopus: 92%; Chicken: 92%; Mouse: 92%; Rat: 92%; Zebrafish: 85%. | |
Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction