Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Mitochondrial Ribosomal Protein S18C Antibody, Novus Biologicals™

Mitochondrial Ribosomal Protein S18C Antibody, Novus Biologicals™
SDP

Catalog No. NB437696 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
25ul
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB437696 25ul
NBP214807 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB437696 Supplier Novus Biologicals Supplier No. NBP21480725UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Mitochondrial Ribosomal Protein S18C Polyclonal specifically detects Mitochondrial Ribosomal Protein S18C in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen Mitochondrial Ribosomal Protein S18C
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias 28S ribosomal protein S18c, mitochondrial, CGI-134, mitochondrial ribosomal protein S18-1, mitochondrial ribosomal protein S18C, MRP-S18-1, MRPS18-1, MRPS18-1mitochondrial, mrps18-c, MRP-S18-c, MRPS18C mitochondrial ribosomal protein S18C, S18mt-c
Gene Symbols MRPS18C
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the amino acids: HVDYKNVQLLSQFVSPFTGCIYGRHITGLCGKKQKEITKAIKRAQIMGFMPVTYKDPAYLKDPKVCNIRYR
Purification Method Affinity Purified
Quantity 25ul
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 51023
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.