Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MKK4/MEK4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP257194
Description
MKK4/MEK4 Polyclonal specifically detects MKK4/MEK4 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
MKK4/MEK4 | |
Polyclonal | |
Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
c-Jun N-terminal kinase kinase 1, dual specificity mitogen-activated protein kinase kinase 4, JNK activating kinase 1, JNK-activated kinase 1, JNK-activating kinase 1, JNKK, JNKK1MAPK/ERK kinase 4, MAP kinase kinase 4, MAPKK4, MEK4MEK 4, mitogen-activated protein kinase kinase 4, MKK4SAPK/ERK kinase 1, PRKMK4MAPKK 4, SEK1, SERK1EC 2.7.12.2 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
MAP2K4 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PAVSSMQGKRKALKLNFANPPFKSTARFTLNPNPTGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLGEI | |
100 μL | |
Angiogenesis, Cancer, MAP Kinase Signaling, Protein Kinase, Signal Transduction, Tyrosine Kinases | |
6416 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction