Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MKK4/MEK4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
| Antigen | MKK4/MEK4 |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
MKK4/MEK4 Polyclonal specifically detects MKK4/MEK4 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| MKK4/MEK4 | |
| Polyclonal | |
| Rabbit | |
| Angiogenesis, Cancer, MAP Kinase Signaling, Protein Kinase, Signal Transduction, Tyrosine Kinases | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 6416 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PAVSSMQGKRKALKLNFANPPFKSTARFTLNPNPTGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLGEI | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| c-Jun N-terminal kinase kinase 1, dual specificity mitogen-activated protein kinase kinase 4, JNK activating kinase 1, JNK-activated kinase 1, JNK-activating kinase 1, JNKK, JNKK1MAPK/ERK kinase 4, MAP kinase kinase 4, MAPKK4, MEK4MEK 4, mitogen-activated protein kinase kinase 4, MKK4SAPK/ERK kinase 1, PRKMK4MAPKK 4, SEK1, SERK1EC 2.7.12.2 | |
| MAP2K4 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title