MKK7/MEK7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP256278

Catalog No. NBP256278

Description

MKK7/MEK7 Polyclonal specifically detects MKK7/MEK7 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: MKK7/MEK7
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: c-Jun N-terminal kinase kinase 2, dual specificity mitogen-activated protein kinase kinase 7, EC 2.7.12.2, JNK kinase 2, JNK-activating kinase 2, JNKK 2, JNKK2, MAP kinase kinase 7, MAPK/ERK kinase 7, MAPKK7, MEK 7, MEK7, mitogen-activated protein kinase kinase 7, MKK7MAPKK 7, PRKMK7
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: MAP2K7
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RHMLGLPSTLFTPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHVIAVK
• Quantity: 100 μL
• Research Discipline: Protein Kinase
• Gene ID (Entrez): 5609
• Target Species: Human
• Isotype: IgG

For Research Use Only