Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MKLP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP256923
Description
MKLP1 Polyclonal specifically detects MKLP1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
MKLP1 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
kinesin family member 23, kinesin-like 5 (mitotic kinesin-like protein 1), Kinesin-like protein 5, kinesin-like protein KIF23, KNSL5CHO1, mitotic kinesin-like 1, MKLP-1, MKLP1Mitotic kinesin-like protein 1 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
KIF23 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:APPIRLRHRRSRSAGDRWVDHKPASNMQTETVMQPHVPHAITVSVANEKALAKCEKYMLTHQELASDGEIETKLIKGDIYKTRGGGQSVQFTDIETL | |
100 μL | |
Cell Cycle and Replication, Core ESC Like Genes, DNA Repair, Stem Cell Markers | |
9493 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction