Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MKLP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $646.00
Specifications
Antigen | MKLP1 |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
MKLP1 Polyclonal specifically detects MKLP1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
MKLP1 | |
Polyclonal | |
Rabbit | |
Cell Cycle and Replication, Core ESC Like Genes, DNA Repair, Stem Cell Markers | |
kinesin family member 23, kinesin-like 5 (mitotic kinesin-like protein 1), Kinesin-like protein 5, kinesin-like protein KIF23, KNSL5CHO1, mitotic kinesin-like 1, MKLP-1, MKLP1Mitotic kinesin-like protein 1 | |
KIF23 | |
IgG | |
Affinity Purified |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
9493 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:APPIRLRHRRSRSAGDRWVDHKPASNMQTETVMQPHVPHAITVSVANEKALAKCEKYMLTHQELASDGEIETKLIKGDIYKTRGGGQSVQFTDIETL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title