MKRN1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155226

Catalog No. NBP155226

Description

MKRN1 Polyclonal specifically detects MKRN1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: MKRN1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: E3 ubiquitin-protein ligase makorin-1, EC 6.3.2.-, FLJ21334, makorin ring finger protein 1, RNF61RING finger protein 61
• Host Species: Rabbit
• Molecular Weight of Antigen: 16 kDa
• Quantity: 100 μL
• Research Discipline: Zinc Finger
• Gene ID (Entrez): 23608
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9UHC7
• Gene Symbols: MKRN1
• Immunogen: Synthetic peptides corresponding to MKRN1(makorin, ring finger protein, 1) The peptide sequence was selected from the N terminal of MKRN1. Peptide sequence GDRCRYEHSKPLKQEEATATELTTKSSLAASSSLSSIVGPLVEMNTGEAE.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Rabbit: 83%; Zebrafish: 77%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Form: Purified

For Research Use Only